Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G78700.1
Common NameBEH4, F9K20.26
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family BES1
Protein Properties Length: 325aa    MW: 34697.4 Da    PI: 7.3048
Description BES1/BZR1 homolog 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G78700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasaspesslqss 97 
                  ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++ e++e++g sa+asp+ss+q  
                  5899**********************************************************************999*******************.. PP

       DUF822  98 lkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                        +sp++sy++sp ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
                  ......**********************9999998788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.6E-643140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009052anatomyflower pedicel
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.108910.0bud| root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasAT1G78700-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
Motif logo
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Regulation -- Hormone ? help Back to Top
Source Hormone
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G78700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565187.10.0BES1/BZR1 homolog 4
SwissprotQ9ZV880.0BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLD7KVU20.0D7KVU2_ARALL; Putative uncharacterized protein
STRINGAT1G78700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP15951542
Publications ? help Back to Top
  1. Wang ZY, et al.
    Nuclear-localized BZR1 mediates brassinosteroid-induced growth and feedback suppression of brassinosteroid biosynthesis.
    Dev. Cell, 2002. 2(4): p. 505-13
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
  3. Yin Y, et al.
    A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.
    Cell, 2005. 120(2): p. 249-59
  4. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
  5. Wang Y, et al.
    Strigolactone/MAX2-induced degradation of brassinosteroid transcriptional effector BES1 regulates shoot branching.
    Dev. Cell, 2013. 27(6): p. 681-8